Dermazone StoreDermazone StoreDermazone Store

Coxir Intensive EGF Peptide Emulsion - 150 ml

ريال140.30

جميع الأسعار شاملة الضريبة

⦿ Deeply hydrates and improves skin texture
⦿ Reduces fine lines and wrinkles with peptides and collagen
⦿ Brightens and evens out skin tone
⦿ Lightweight, fast-absorbing formula
⦿ Free from parabens and fragrances

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

The Coxir Peptide Emulsion is a lightweight, fast-absorbing moisturizer designed to deeply hydrate and smooth the skin. With a blend of peptides and collagen, it helps improve skin elasticity while reducing the appearance of fine lines and wrinkles. This emulsion also supports skin brightening and helps even out skin tone, making it ideal for all skin types, including sensitive skin.

Its gentle formula works to calm the skin while providing long-lasting hydration and protection against the signs of aging.

Product Details:

  • Size: 150ml
  • Brand: Coxir
  • Country of Origin: Korea
  • Skin Type: All skin types, including sensitive skin

Key Benefits

  • Deeply hydrates while improving skin texture.
  • Helps reduce the appearance of fine lines and wrinkles with peptides and collagen.
  • Brightens and evens out skin tone.
  • Lightweight formula that absorbs quickly, suitable for daily use.
  • Free from harsh chemicals like parabens and fragrances.

Key Ingredients

  • EGF (Epidermal Growth Factor): Promotes skin cell renewal and boosts collagen production, helping to prevent fine lines and wrinkles.
  • Peptides: Stimulate collagen production and reduce the appearance of wrinkles.
  • Collagen: Supports skin elasticity and helps prevent signs of aging.

How to Use

  1. Cleanse your face thoroughly.
  2. Apply toner to the skin using your hands or a cotton pad.
  3. Follow with the Peptide Emulsion by gently massaging it into the face and neck, starting from the center of the face and moving outward.
  4. Lightly pat the skin to encourage absorption.

Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Intensive EGF Peptide Emulsion - 150 ml

ريال140.30
Chat now