Dermazone StoreDermazone StoreDermazone Store

Coxir EGF Peptide Toner - 150 ml

ريال132.25

جميع الأسعار شاملة الضريبة

⦿ Coxir Peptide Toner for balance skin moisture
⦿ Get rid of wrinkles and fine lines
⦿ Deep hydration
⦿ All skin types
⦿ Enhance skin health
⦿ Get rid of extra oils and dead skin

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

A highly absorbent intense peptide toner, rich in elements that help fight wrinkles and fine lines, in addition to deep hydration that go inside into the layers of the skin, and balancing the moisture and oils in the skin.

This toner, suitable for all skin types, helps strengthen the skin barrier, renew cells, and get rid of damaged cells. Because it contains a high amount of peptide and collagen.

Product Details

Product size: 150 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Clean the face very well with cleanser.

  • Put an appropriate amount of toner on the palm of the hand or on a piece of cotton.

  • Gently wipe all face and neck.

Ingredients

  • EGF: A formula that revitalizes the skin and accelerates cell regeneration in addition to enhancing collagen production to prevent the formation of wrinkles and fine lines.

  • Peptide: Stimulates collagen production, skin regeneration, and reduces fine lines and wrinkles. It also reduces skin redness and irritation.

  • Collagen: Maintains skin elasticity and elasticity and helps prevent signs of aging for more radiant skin.

Why Use Peptide Toner

  • Rich moisturizing toner helps balance skin moisture.

  • Helping get rid of wrinkles and fine lines.

  • Rich in peptides that help improve skin health.

  • Free of harsh materials on the skin, such as parabens and perfumes.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir EGF Peptide Toner - 150 ml

ريال132.25
Chat now