Dermazone StoreDermazone StoreDermazone Store

Coxir Intensive EGF Peptide Serum - 50ml

ريال144.90

جميع الأسعار شاملة الضريبة

⦿ Intense hydration and reduces fine lines and wrinkles
⦿ Strengthens skin barrier and locks in moisture
⦿ Improves the appearance of scars and enhances skin texture
⦿ Lightweight and fast-absorbing, suitable for day and night use
⦿ Free from parabens and alcohol

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Intensive Hydrating & Anti-Aging Serum

Product Overview

The Coxir Peptide Serum is a highly concentrated, hydrating serum designed to enhance skin elasticity and address common skin concerns such as dryness, fine lines, and wrinkles. It helps repair damage, renew skin cells, and strengthen the skin barrier while locking in moisture.

This serum is effective for improving the appearance of old scars and blemishes, and it can be used both day and night. It absorbs quickly without leaving any residue, making it suitable for daily use.

Product Details

  • Size: 50ml
  • Brand: Coxir
  • Country of Origin: Korea
  • Skin Type: All skin types

Key Benefits

  • Intense hydration and reduction of fine lines and wrinkles.
  • Strengthens the skin barrier and locks in moisture.
  • Improves the appearance of scars and enhances skin texture.
  • Lightweight formula that absorbs quickly, suitable for day and night use.
  • Free from harsh ingredients like parabens and alcohol.

Key Ingredients

  • EGF (Epidermal Growth Factor): Enhances skin health by promoting cell renewal and collagen production to prevent wrinkles and fine lines.
  • Peptides: Stimulate collagen production, reduce fine lines and wrinkles, and minimize redness and irritation.
  • Collagen: Supports skin elasticity and helps prevent signs of aging for a more youthful appearance.
  • Panthenol: Provides deep hydration and improves skin elasticity.
  • Niacinamide: Aids in skin cell renewal and reduces the appearance of fine lines and wrinkles.

How to Use

  1. Cleanse your face thoroughly.
  2. Apply a suitable amount of serum to your face and neck as the final step in your skincare routine, after moisturizers.
  3. Gently massage and pat the serum into your skin to enhance absorption.
  4. Can be used both morning and evening.

Warnings:

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Discontinue use if irritation occurs.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Intensive EGF Peptide Serum - 50ml

ريال144.90
Chat now