Dermazone StoreDermazone StoreDermazone Store

Coxir Black Snail Collagen Cream - 50 ml

ريال149.69

جميع الأسعار شاملة الضريبة

⦿ Black snail collagen cream for skin lifting
⦿ Deep and effective moisturizing
⦿ Get rid of dead skin
⦿ All skin types
⦿ Enhance skin health and glow
⦿ Locks in moisture in skin and get rid of dryness

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

We offer you black snail collagen cream, made by experts to effectively repair, tighten, moisturize and nourish the skin. It contains the most important natural ingredients, such as collagen extracted from the black snail, which is famous for its ability to restore the skin and improve its texture and glow.


This cream deeply moisturizes the skin, locks in moisture and eliminates dryness. It is also quick to absorb without making skin feel sticky.

Product Details

Product size: 50 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • This cream is used in the last step of the skin care routine after cleansing it and using all serums and care creams.

  • Apply a proper amount of cream to the entire face, then distribute it gently with a light massage to enhance absorption.

Ingredients

  • Black Snail Collagen: Maintains skin moisture and protects it from dryness, in addition to effectively improving skin elasticity.

  • Black Bean Extract: Contains nourishing vitamins and minerals that strengthen the skin barrier and give it a healthy appearance.

  • Natural Collagen: Provides deep hydration to the skin, prevents the appearance of fine lines and improves its texture.

  • Sesame: Moisturizes the skin and gets rid of dead skin cells.

  • Peptide: Stimulates collagen in the skin and reduces fine lines and wrinkles.

Why Use Black Snail Collagen Cream

  • Fast absorption and does not leave stickiness on the skin.

  • Deep moisturizing and getting rid of damaged skin cells.

  • Nourish and repair the skin.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 57 reviews
75%
(43)
5%
(3)
9%
(5)
4%
(2)
7%
(4)
م
مليحة الزهراني
قلوة

لم استلم الطلبية ولم توصل المنتجات لقد تأخرت كثيرا

A
Alanoud Alharbi

الغسول و التونر جدا رائعة واقيمها 5 ولكن السيروم والكريم لم تناسبني

م
مانع ال مطارد
الرياض

جميل للغايه

ه
هند محمد

كوكسير كريم كولاجين الحلزون الأسود

N
Nada Mohammed

كوكسير كريم كولاجين الحلزون الأسود

Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Black Snail Collagen Cream - 50 ml

ريال149.69
Chat now