Dermazone StoreDermazone StoreDermazone Store

Moms Bath Enhanced Skin Hydration Package

ريال454.25

جميع الأسعار شاملة الضريبة

⦿ Highly Effective Body Milk for Deep Hydration
⦿ Exfoliating Scrub Cloth to Eliminate Dead Skin Cells
⦿ Soy Milk Mask for Skin Nourishment & Moisturization
⦿ Exfoliating Scrub Cloth to Revitalize Pores & Enhance Nutrient Absorption
⦿ Body Milk for Skin Brightening & Locking in Moisture
⦿ Soy Milk Mask for Collagen Boost, Improved Skin Elasticity, and Radiant Skin

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Enhanced Hydration Package From Moms Bath

Package Contents 

This package contains a versatile set of skincare products from Moms Bath designed to boost long-lasting hydration throughout the day, even after showering. It includes products for body and pore cleansing to enhance the absorption of moisturizing ingredients. The following products are included:

1. Moms Bath Body Scrub - Original This scrub features gentle exfoliating elements that effectively remove accumulated dead skin cells, promoting skin freshness and vitality. It aids in skin brightening with short-term use, as well as pore cleansing to enhance the absorption of moisturizing products.

Usage Instructions:

  • Rinse the entire body with lukewarm water, then thoroughly scrub the body with the white side of the scrub until lathering.
  • Use the green textured side to scrub elbows, knees, and ankles to eliminate stubborn dead skin cells.
  • Rinse the body completely with lukewarm water.
  • Use the scrub 2-3 times a week.
  • It is advisable to test a small area of the body to ensure no skin sensitivity.

2. Moms Bath Body Milk - 200ml This body milk provides noticeable hydration from the first use, which lasts even after it's absorbed. Its fast-absorbing formula moisturizes and soothes the skin, aiding in skin brightening without leaving any sticky residue.

Usage Instructions:

  • Apply an appropriate amount of the body milk to wet skin and start massaging.
  • Rinse the body thoroughly with water and gently pat dry with a towel.
  • It can also be used without rinsing for easy absorption.

3. Moms Bath Soy Milk Mask - 70g This mask is made from raw soy milk, which fills the skin pores with highly moisturizing elements after they open due to steam from showering and scrubbing. It enhances hydration, freshness, collagen production for early aging prevention, evens skin tone, and helps eliminate dark spots.

This mask contains a wide range of vitamins and minerals rich in youth-renewing elements that significantly nourish the skin.

Usage Instructions:

  • Apply an appropriate amount of the mask to the skin after showering and thorough cleansing for 5-10 minutes, then rinse. It can also be used on the face.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Moms Bath Enhanced Skin Hydration Package

ريال454.25
Chat now