Dermazone StoreDermazone StoreDermazone Store

    Collagen Plus | Nourishing Marine Collagen


    جميع الأسعار شاملة الضريبة

    Tighter, younger and brighter looking skin
    Moisturizes the skin and makes it supple
    Reduces appearance of wrinkles and fine lines
    Marine Collagen Pure (95%), fast absorbing
    Collagen drink with blueberry extract and vitamin C

    Sold out

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Order during to get it on hoursminutes
    Viewers are watching this product now

    Sensilab Collagen Plus - Reduces effects of skin aging and contributes to normal collagen formation

    Product Overview

    Marine collagen for the skin with blueberry extract and vitamin C, has a high absorption capacity, as results usually appear within 14 days! It reduces wrinkles and fine lines, moisturizes the skin and protects it from drying out.

    Marine Collagen Plus has the ultimate formula for healthier skin 

    Hydrolyzed type I collagen - collagen is a major protein found in the connective tissue and skin (more than 75%) which plays an essential role in the maintaining of skin tone, suppleness, and elasticity. 

    Hyaluronic Acid - hydrates the skin and makes it firmer.

    Blueberry - one of the richest natural sources of anthocyanins with strong antioxidant effects.

    vitamin C - contributes to collagen formation which is required for the normal functioning of the skin.

    Regular use of Marine Collagen Plus helps in improving collagen fibers and helps the skin to provide an alternative source of Type 1 Collagen, while at the same time stimulating its natural production. Which makes the skin more elastic and supple, retains moisture and reduces the appearance of wrinkles and facial lines, and therefore consuming a 100% natural source of collagen is enough to give the skin a lively and youthful appearance.

    Marine Collagen Plus Benefits

    • 100% Natural Source of Collagen Type 1

    • Pure marine collagen (95%), fast absorbing.

    • Gives firmer, younger and more radiant skin.

    • Moisturizes the skin and makes it supple. It reduces the appearance of wrinkles and fine lines.

    • Makes nails and hair stronger and shinier.

    • Suitable for those who follow a diet as it does not contain fats or carbohydrates.

    • Suitable for vegetarians.

    Analytical Studies On Collagen Plus

    An analytical study, involving 40 women, showed that marine naticol, the main ingredient of Collagen Skin Lift, had positive effects on skin appearance.

    • Improve skin moisture after six weeks of use by 23%.

    • Enhance skin satisfaction by 9.4%

    • Increase flexibility by 23.7%.

    Product information


    5000 mg Marine Source Collagen Peptides (Natural Fish Collagen Type 1), 1000 mg Bilberry Extract, 90 mg Vitamin C (Ascorbic Acid), 50 mg Zinc Gluconate, 7.25 mg Zinc.

    Product details

    • Pack Capacity: 15 Sachets.
    • Brand: Sensilab
    • Age Group: For women aged 25 and over.
    • Industry: France

    Instructions for use

    Empty the contents of one sachet into 200 ml of water, and drink it once daily (cold water can be used as it has solubility), with the need to maintain a balanced diet. Collagen Plus is a nutritional supplement and is not a substitute for food.

    How to achieve the best results

    • Stick to drinking one scoop of collagen syrup daily.
    • Continue using the collagen syrup 2-3 months.
    • Dietary supplements are not a substitute for a balanced diet.

    * It is recommended to take one sachet daily, for a period of 2 to 3 months, knowing that the initial effects usually appear after two weeks of use.


    • Do not exceed the recommended dose.
    • Do not store the product in a humid place, keep at room temperature away from light.
    • Do not leave the product within the reach of children.

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail

    Customer Reviews

    Based on 45 reviews
    Nouf Alotibi

    طعم غير مقبول

    اماني الحربي

    كولاجين بلس البحري | 15 مغلف بودرة بنكهة التوت البري

    Mohab Ayaz
    لم استلم منتجات بسبب عدم اهتمام العملاء

    لا انصح بالتعامل مع شركتكم
    أنا طلبت من عندكم وما وصلني الطلبيه بسبب اني عطيتهم رقم ثاني على رغم اني تواصلت مع الشركه من يوم اول وكل يوم سألتهم عن متى يوصل الطلبية عن طريق الواتساب واحيانا الموظفين كانوا ما يردون علّى إلا بعد ثلاث او اربع ايام

    كنت متحمسه اجرب منتجاتكم بس خدمتكم سيئة

    خلود الجهني


    أريج المطيري

    كولاجين بلس البحري | 15 مغلف بودرة بنكهة التوت البري

    Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
    Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
    January, February, March, April, May, June, July, August, September, October, November, December
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your shopping cart is empty.

    Back to Shop

    Add notes to the order Edit notes
    Estimate shipping costs
    Add discount code

    Estimate shipping costs

    Add discount code

    The coupon code will work on the checkout page

    Collagen Plus | Nourishing Marine Collagen

    Chat now