Dermazone StoreDermazone StoreDermazone Store
Sold out

Mom's Bath Ultimate Body Care Package

ريال599.37

جميع الأسعار شاملة الضريبة

  • 3 Packs of the original exfoliating loofah for body cleansing
  • The original exfoliating loofah to get rid of dead skin cells
  • Safe and easy to use
  • Contain natural oils and ingredients inspired by korean bath
  • Contains yogurt, honey, hinoki cypress and willow bark
  • Each pack contains 8 loofah

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

The Ultimate Body Care by Moms Bath

Package Details

In this exceptional package, we present a range of products designed to provide the best care for your body and skin, addressing common issues like acne and skin problems. Our goal is to offer the necessary care, rejuvenation, and improvement for flawless, blemish-free skin. This collection includes the following:

1. Hydrating Body Milk - 200 ml

This body milk provides effective hydration during and after your shower. Its fast-absorbing formula, enriched with yogurt and honey, moisturizes and soothes your skin without leaving any residue, while visibly brightening your complexion.

How to Use: Apply an appropriate amount to your wet body, gently massage, rinse thoroughly, or leave it on for enhanced moisture.

2. Exfoliating Wipes with Vitamins - 45 Sheets

These wipes are packed with powerful exfoliating vitamins that are gentle on your skin, promoting freshness and radiance for up to 24 hours after use. They also contain potent skin moisturizers like hyaluronic acid mixed with panthenol, effectively removing dead skin cells and smoothing your skin's texture.

How to Use: Use the wipe to gently rub all over your body, paying extra attention to dry areas, and use the remaining oil on the wipe for hair moisturizing.

3. Powerful Exfoliating Mitt for Skin Issues

This mitt's potent formulation tackles impurities, dirt, and acne-causing oils. It also addresses stubborn dead skin cells, improves skin texture, provides adequate moisture, balances skin pH, evens out skin tone, and reduces fine lines, all without irritating the skin.

How to Use: Rinse your body thoroughly with water, gently rub with the mitt using the white patterned side to create a rich keratin foam, focus on tough areas like elbows and ankles, rinse your entire body with lukewarm water, use the mitt 2-3 times a week, and perform a patch test before full use to ensure no skin sensitivity.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now