Dermazone StoreDermazone StoreDermazone Store
Sold out

Mom's Bath Recipe - Body Peeling Pad - Strong Care

ريال172.50

جميع الأسعار شاملة الضريبة

  • Body Peeling Loofah for effective exfoliating and hydrating
  • Strong Body Peeling Pad with With Seaweed Extract, Postbiotics, Hinoki Cypress Scent, Pineapple Enzyme, and Fermented Pumpkin Extract
  • Effective by cleaning the skin and removing dead cells, chicken skin
  • Contain natural oils and ingredients inspired by korean bath
  • Save and easy to use
  • Enhance relaxation and stress relieve

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Product Overview

The strong exfoliating loofah from Mom's Bath known by being a loofah for cleaning and exfoliating the body at the same time, inspired by the ancient Korean bath, which is famous of removing dead skin by using the best and oldest types of Korean skin recipes in a modern way that is easily suitable for daily use.

The powerful exfoliating loofah contains a powerful cleansing solution made of fruit enzymes such as pineapple enzyme (bromelain) and fermented pumpkin extract; To remove old dead skin, flaky skin and chicken skin (which are spots that appear on the surface of the skin), also it has many moisturizing ingredients such as sea kelp extract and postbiotics; For powerful, immediate exfoliation and hydration Scented with the scent of Hinoki Cypress; To relieve stress and tension.

This loofah is designed for double-sided use: a white side for all areas of the body, rich in foam with active ingredients, and a red side for intense exfoliation for the elbows and ankles, designed to remove old dead skin cells. Each loofah is contained in a special envelope sufficient for one use, and each package contains 8 loofahs.

Continued use also reduces scarring; Because it contains raw seaweed extract, which has other advantages in eliminating dry skin and enhancing hydration after showering.

Product Details

Product size: 8 loofah in one box.

Brand: Mom’s Bath Recipe

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Rinse the entire body with water.

  • Open the envelope to take out the loofah and use it by placing it in the hand and rubbing the body carefully with the white side to obtain the foam rich in keratin and other active substances.

  • The red patterned side is used to get rid of old dead skin cells on the ankles, elbows and other areas of the body.

  • Rinse the entire body with lukewarm water.

  • It is recommended to use it 2-3 times a week.

  • It is recommended to test the loofah on a small area of ​​the skin to ensure that there is no allergy.

  • You can use a soy milk wash off mask and leave it for 5-10 minutes while drying. To enjoy a shower rich in powerful cleansing and moisturizing.

Why Body Peeling Pad Strong Care

  • Easy to use and eliminates the need for exfoliating baths.

  • Easily used at home.

  • Easy to carry while traveling.

  • Effective in moisturizing and exfoliating the body.

  • It contains oils and natural ingredients that are important for the skin.

  • Enhance skin radiance and remove old tough dead skin cells.

  • Relieve stress and fatigue during showering.

  • Balancing moisture and hydration.

  • Enhance the glowness of tired skin.

  • Suitable for skin with old dead skin, flaky skin and chicken skin.

Warnings

  • Stop using the loofah as soon as any abnormal changes appear on the skin.

  • Wash eyes immediately after contact with the loofah with plenty of water.

  • Keep the loofah out of the reach of children.

  • Store the loofah in a cool, dry place.

  • Keep the loofah away from direct sunlight.

  • It is not recommended for use by pregnant women.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 24 reviews
58%
(14)
0%
(0)
8%
(2)
13%
(3)
21%
(5)
F
Fatimah Al-qahitan

علبة مومز باث ليفة تقشير الجسم ( علبة ٨ ليف)

W
Wejdan M

عادية جداً ما تسوى سعرها صراحه هي صح تشيل الجلد الميت لكن ما تعطي نتيجة مثل ما قالوا !!!

ف
فايزه الموسى

رائعة

R
Reema Aldosari

علبة مومز باث ليفة تقشير الجسم ( علبة ٨ ليف)

R
RH

علبة مومز باث ليفة تقشير الجسم ( علبة ٨ ليف)

Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now