Dermazone StoreDermazone StoreDermazone Store

Moms Bath Deep Hydration & Skin Repair Bundle


جميع الأسعار شاملة الضريبة

  • Trouble Body Peeling Loofah to reduce skin problems such as acne
  • LHA Vitamin Glow Bath to enhance skin glow
  • Soy Milk Mask for skin deep nourish
  • Wash Off Milk for deep hydration and unifying skin tone
  • Extra hydration and get rid of skin problems bundle
  • Enhance skin health and get rid of dead skin cells

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Deep Hydration & Skin Repair Package by Moms Bath

Package Contents

Experience the ultimate hydration and tackle tough skin concerns with our specially curated collection. Say goodbye to stubborn dead skin cell buildup that clogs pores and leads to acne. Our collection includes the following Moms Bath products:

  1. Body Lotion - 200ml

    • This body lotion is your go-to solution for deep hydration from the very first application. Its advanced fast-absorbing formula moisturizes and soothes the skin, promoting effective brightening without leaving any greasy residue.


    • Apply an appropriate amount to wet skin and gently massage.
    • Rinse thoroughly and pat dry with a towel.
    • Can also be used without rinsing for easy absorption.
  2. Soy Milk Mask - 70g

    • Our soy milk mask is designed to deeply hydrate your skin. It penetrates the skin's pores after a steamy shower or bath, improving skin radiance and protecting against early signs of aging. It also helps even out skin tone and reduce dark spots.


    • Apply an adequate amount to your body after showering and cleansing your skin.
    • Leave on for 5-10 minutes, then rinse, or you can also use it on your face.
  3. Vitamin-Infused Exfoliating Wipes - 45 Sheets

    • Our gentle exfoliating wipes are perfect for refining skin texture and enhancing skin freshness for up to 24 hours. Packed with moisture-rich ingredients like hyaluronic acid and panthenol, along with essential vitamins, these wipes remove dead skin cells and even out skin texture.


    • Gently rub the skin using the refreshing wipe, paying extra attention to dry areas.
    • For added moisture, use any remaining oil on the wipe on your hair.
    • Use these wipes regularly for deep cleansing and to boost skin freshness.
  4. Exfoliating Cloth for Body

    • This powerful exfoliating cloth eliminates impurities, dirt, and excess oils that contribute to common skin issues such as acne and stubborn dead skin cells. It significantly improves skin texture, moisturizes effectively, balances skin pH, evens out skin tone, and gently reduces fine lines without causing irritation.


    • Rinse your body thoroughly with water and gently rub using the effective side with the white pattern to create a rich, foamy lather.
    • Use the green patterned side to exfoliate tougher areas like elbows and ankles for the best results.
    • Rinse your body completely with lukewarm water.
    • Use the cloth 2-3 times a week.
    • We recommend patch testing a small area of your skin to ensure no skin sensitivities.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail

Customer Reviews

Be the first to write a review
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Moms Bath Deep Hydration & Skin Repair Bundle

Chat now