Dermazone StoreDermazone StoreDermazone Store
Sold out

Moms Bath Skin Brightening Bundle

ريال517.50

جميع الأسعار شاملة الضريبة

  • Nourishing Body Milk for Hydration & Skin Nutrition
  • Salicylic Acid Cleansing Wipes for Exfoliation & Radiance
  • Original Exfoliating Cloth for Pore Cleansing & Tightening
  • Skin-Lightening Body Milk with Moisture Lock
  • Salicylic Acid Cleansing Wipes for Dirt & Residue Removal
  • Original Exfoliating Cloth for Dead Skin Cell Removal & Skin Cleansing

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Skin Brightening Bundle by Moms Bath

Bundle Description 

Experience radiant, glowing skin with our Moms Bath Skin Brightening Bundle. These products are expertly formulated to reduce stubborn discolorations and promote a brighter complexion without causing any skin irritation. Discover the benefits of this bundle, featuring the following products:

  1. Moms Bath Body Milk - 200 ml:

    • This luxurious body milk, enriched with yogurt and honey extracts, provides deep hydration to your skin during and after your shower.
    • Its fast-absorbing formula soothes and moisturizes your skin, leaving it brighter and more supple without any sticky residue.

    How to Use:

    • Apply an appropriate amount of body milk to wet skin and gently massage.
    • Rinse with water and pat dry with a towel, or leave it on for quick absorption.
  2. Moms Bath Vitamin-Infused Exfoliating Body and Face Wipes - 45 Wipes:

    • These convenient wipes instantly boost your skin's radiance and freshness for up to 24 hours.
    • Packed with a blend of effective exfoliating vitamins and potent moisturizers like Hyaluronic Acid and Panthenol.
    • These wipes effectively remove dead skin cells while keeping your skin smooth and hydrated.

    How to Use:

    • Gently use the wipes to cleanse your entire body, applying slight pressure during the process.
    • Pay extra attention to areas like elbows and knees for improved firmness.
    • Apply any remaining oils on the wipe to your hair for added hydration and a pleasant fragrance.
    • For deep cleansing and enhanced skin radiance, use these wipes regularly.
  3. Moms Bath Original Exfoliating Body Cloth:

    • This gentle yet highly effective body cloth exfoliates the skin, revealing a brighter complexion with regular use.
    • It hydrates your skin with potent moisturizing ingredients such as yogurt and honey.
    • Each box contains 8 cloths, and each cloth is designed for a single use.

    How to Use:

    • Wet your entire body, then slip the cloth onto your hand and gently massage your body using the white side to create a rich lather.
    • Use the green textured side to target stubborn areas like elbows, knees, and ankles for the removal of dead skin cells.
    • Rinse your entire body thoroughly with warm water.
    • Use the cloth 2-3 times a week for best results.
    • To ensure there is no skin sensitivity, it's advisable to test a small area of your skin before regular use.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now