Dermazone StoreDermazone StoreDermazone Store
Sold out

Mom's Bath Recipe - Body Care Exfoliating Pad

ريال202.33

جميع الأسعار شاملة الضريبة

  • Body Peeling Loofah for effective body exfoliation and hydration
  • A loofah to get rid of skin problems such as acne and sebum
  • Effective by cleaning the skin and removing dead cells, also unifying tone and texture
  • Contain natural oils and ingredients inspired by korean bath
  • Save and easy to use
  • Enhance relaxation and stress relieve

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Product Overview

This body care loofah is used for acne-prone skin. Because of its ability to gently exfoliate the skin and get rid of both dead skin cells and oils that cause pimples, also to reduce wrinkles and smoothing the skin to obtain a homogeneous texture; Because of the salicylic acid in it.

The exfoliating loofah for body problems contains intensely effective fruit acids to reduce acne problems, plaque residue, sebum, and dead skin, also many skin moisturizing ingredients. To obtain strong and immediate exfoliation and moisturization and relieve annoying skin problems.

The loofah contains two sides, the white one for all areas of the body, which is rich in effective foam, and the second side is used for difficult areas, including elbows and knees.

This loofah replaces the need for baths to exfoliate the body and get rid of skin problems and is therefore an ideal alternative to the Moroccan and Turkish bath.

This loofah balances the acidity of the skin and helps soothe it. Because it contains extracts of many herbs that rejuvenate the skin, reduce fine lines and wrinkles, and help unify color. It also contains extracts of persimmon fruit leaves, green tea, and madecassoside, which soothe the skin and reduce the effects of irritation and redness.

The loofah is for single use only, and each loofah is placed in one envelope in a box containing 8 loofahs.

Product Details

Product size: 8 loofah in one box.

Brand: Mom’s Bath Recipe

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Rinse the entire body with water.
  • Open the package to use the loofah after placing it in the hand and gently rubbing the body from the white patterned side until the foam rich in keratin intended for body care appears.
  • Get rid of stubborn dead skin cells on your ankles and elbows using the other embossed side.
  • Rinse the entire body with lukewarm water.
  • Use a loofah 2-3 times a week.
  • It is recommended to test a small area of ​​the body to ensure that no skin allergies occur.
  • You can then use Moms Bath body milk. To enhance body hydration, improve skin texture and soothe; To get integrated care.

Why Body Peeling Pad Trouble Care

  • Easy to use and eliminates the need for exfoliating baths.
  • Easily used at home.
  • Easy to carry while traveling.
  • Effectively exfoliates and moisturizes the body.
  • It is composed of natural ingredients and oils that are beneficial for the skin.
  • Designed for acne-prone skin.
  • Helps even out skin texture.
  • Remove dead skin and enhance skin freshness.
  • Relieve stress and fatigue during showering.
  • Suitable for skin with old dead skin and flaky skin.
  • Reducing acne and oily secretions without irritating the skin.

Warnings

  • Stop using the loofah as soon as any abnormal changes appear on the skin.
  • Wash eyes immediately after contact with the loofah with plenty of water.
  • Keep the loofah out of the reach of children.
  • Store the loofah in a cool, dry place.
  • Keep the loofah away from direct sunlight.
  • It is not recommended for use by pregnant women.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 14 reviews
64%
(9)
7%
(1)
7%
(1)
14%
(2)
7%
(1)
h
hassan Alhrby

علبة مومز باث ليفة تقشير للتخلص من مشاكل الجسم ( ٨ حبات بالعلبة )

ع
عائشه القحطانب

علبة مومز باث ليفة تقشير للتخلص من مشاكل الجسم ( ٨ حبات بالعلبة )

S
SAOUD ALHAZAA

علبة مومز باث ليفة تقشير للتخلص من مشاكل الجسم ( ٨ حبات بالعلبة )

E
Etedal H

علبة مومز باث ليفة تقشير للتخلص من مشاكل الجسم ( ٨ حبات بالعلبة )

س
ساره الدوسري

علبة مومز باث ليفة تقشير للتخلص من مشاكل الجسم ( ٨ حبات بالعلبة )

Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now