Dermazone StoreDermazone StoreDermazone Store

Watermans Hair and Beard Growth for Men

ريال663.55

جميع الأسعار شاملة الضريبة

⦿ يمنع شامبو جرومي تساقط الشعر ويحسّن نموّه
⦿ يحسن بخاخ جرومر مشاكل التساقط بشكل ملحوظ ويحفّز البصيلات الخاملة
⦿ يسد هير فايبرز فراغات الشعر بشكل طبيعي وثبات قوي
⦿ يغذي شامبو جرومي فروة الرأس
⦿ تناسب هذه المجموعة كافة أنواع الشعر

بيع بالكامل

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Bundle Contents

A complete set of hair care products for men by Watermans, that stop hair loss and fills in hair gaps. This group consists of products that give you effective results and quick solutions; To appear with radiant hair and beard in record time.

Grow Me shampoo For Hair Loss - 250 ml

Waterman's Grow Me Hair Growth Shampoo protects the hair from hair loss, thus, after a period of use, the hair appears thicker and healthier; It contains lupine protein, caffeine, and several important vitamins that promote healthy hair growth and improve scalp health. It is also chemical-free and suitable for all hair types.

How to Use

  1. Apply a small amount of shampoo to wet hair. 
  2. Gently rub both hair and scalp for 3-4 minutes
  3. Rinse hair with lukewarm water. 
  4. It is recommended to use shampoo 4-5 times a week for best results.

Grow More Elixir Hair Thickening Spray - 100 ml

Grow More Hair Serum helps fill in the blanks of the beard and hair through its powerful formula that activates dormant hair follicles, stimulates blood flow to the roots, and nourishes the scalp; This is why it is the UK's #1 selling hair care and thickening product.

How to Use

  1. Spray the serum directly on the hair.
  2. Distribute it evenly on wet scalp. 
  3. Gently massage for one minute and keep it on the hair without rinsing.
  4. Use once per day, it can also be used on a dry scalp.

Hair Fibers - Hair Thickening Fibers - 23 gm

Watermans Hair Fibers fill in the gaps quickly, easily and steadily, and the filled hair gaps appear natural. These fibers are safe while adhering to the hair, and remain stable until the hair is shampooed. The fibers are stable and strong in all weather factors such as wind and rain, and it is the best and fastest solution to cover the gaps naturally on all occasions.

How to Use

Hair thickening fibers are used by shaking a few of them on the gaps, increasing as desired, and then waiting for 30 seconds; So it sticks well.

The Best Hair Care Bundle for Men

This bundle works in an integrated manner by treating hair loss, increasing hair volume, moisturizing it, caring for the scalp, and filling hair gaps quickly and easily. To shine and enjoy healthy and strong hair at all times.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

No reviews yet
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Watermans Hair and Beard Growth for Men

ريال663.55
تحدث الان