Dermazone StoreDermazone StoreDermazone Store

Watermans Hair Fibers - Hair Thickening Fibers (Dark Brown)

ريال207.00

جميع الأسعار شاملة الضريبة

⦿ Fills in the hair gaps
⦿ Suitable for men and women and all hair types
⦿ Gives hair more volume and thickness
⦿ Effective in all weather conditions
⦿ Natural, safe and blends undetectably with your natural hair
⦿ Remains on hair throughout the day until shampooed
⦿ Easy and works in just 30 seconds

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Hair Fibers - Hair Loss Concealer by Watermans - 23 grams

Product Overview

Cover The Gaps With Watermans Hair Thickening Fibers

Watermans Hair Fibers is the fastest and ideal solution for people who suffer from hair loss gaps and thinning hair; It consists of microfibers that contain a constant charge that adheres firmly to the hair without causing any damage. It adapts to the shape of the hair and blends in easily, revealing naturally full and thick looking hair.

These hair thickening fibers are used by many hairdressers as a substitute for hair thickening powder; For its ability to conceal hair gaps and create the illusion of natural thick hair. 

Effective in All Weather Conditions

Watermans Hair Fiber work effectively in all weather factors such as wind, rain and sweat, and it remains in tact throughout the day until the hair is washed with shampoo.

Product Information

Main ingredients

Corn protein: enhances the shine and softness of the hair; Because it contains a high percentage of fatty acids, in order to maintain the hair during use.

Cellulose: It is an organic compound produced from plants and algae, and is included in the composition of hair thickening fibres.

Product Details

Package Capacity: 23g

Brand: Watermans

Age group: Adults.

Country of Origin: United Kingdom.

Skin type: All hair types.

Instructions for Use

1. Blow dry the hair, and style it using your usual styling products.

2. The fiber packet is shaken over the area to be filled.

3. Use a small amount of product, then apply more as desired.

4. Use your fingers to distribute the hair fibers over the thinned areas, to fill all areas naturally.

The product remains on the hair until it is thoroughly washed with shampoo and conditioner

Tips When Using The Product

  • Rubbing the hair vigorously may affect the fibers if they do not adhere well to the hair, but a light touch does not.
  • The product is resistant to all weather conditions; Because the fibers are designed to stick to each strand until the hair is shampooed, heavy rains may affect some of the fibers.
  • The dark brown color is the right choice for most customers; As it is possible to obtain a darker color by increasing the fibers, and to obtain a lighter color by using a small amount.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

No reviews yet
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Watermans Hair Fibers - Hair Thickening Fibers (Dark Brown)

ريال207.00
Chat now