Dermazone StoreDermazone StoreDermazone Store

Haifa's Favorites Collection - For Hair Care

ريال926.90

جميع الأسعار شاملة الضريبة

  • Beauty Gummies to nourish and reduce hair loss
  • Grow Me Shampoo to enhance hair thickness and reduce hair loss
  • Mask Me, hair mask to nourish hair and get rid of damage
  • Hair Oil to hydrate hair and enhance shiness
  • All hair types

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Bundle Overview

We choose this package of Haifa's selections for the perfect hair care; It includes 4 products that help improve hair growth, repair, and enhance its shine and thickness. This package includes all of the following.

1 Sensilab Beauty Gummies For Hair And Nails

Beauty Gummies contain biotin and many important vitamins to nourish hair and reduce hair loss, Also it has a formula that stimulates collagen production to strengthen both hair and nails.

Instruction Of Use
  • Take two pieces daily either together or separately at any time of the day.

Watermans Bundle For Deep Moisturizing And Hair Growth - 3 Products

The deep moisturizing bundle helps strengthen hair against loss, repair damage and provide deep hydration to obtain thick, healthy hair as follows.

Watermans Grow Me Shampoo - 250 ml

Grow me shampoo contains the most important vitamins to nourish hair, It also has biotin and lupine protein. It effectively reduces hair loss within 3 months of use and improves hair texture and hydration. It is also suitable for all hair types, including dyed hair.

Instruction Of Use
  • Use an appropriate amount of shampoo on wet hair.
  • Gently massage the scalp.
  • Leave the shampoo on the hair for 3-4 minutes, then rinse with water.
  • Use shampoo 4-5 times a week; For best results.

Watermans Masque Me Hair Mask - 200 ml

Mask Me hair mask helps get rid of damage and deep dryness of the hair. For having both argan oil and lupine protein, it also contains rosemary oil to nourish the scalp, reduce hair breakage, and enhance shine.

Instruction Of Use
  • Use an appropriate amount of mask on the hair after washing it with shampoo.
  • Distribute the mask from hair endings to the roots.
  • Gently massage the scalp for several minutes.
  • Wrap hair with a towel or shower cap.
  • Wait 10 minutes, then wash the hair well with lukewarm water.
  • It is recommended to use the mask 1-2 times a week. For best results.

Watermans Hair Oyl - 60 ml

Hair Oil moisturizes the hair with remarkable effectiveness. It contains extracts of both camellia flower and black castor oil, which can go deep inside the hair cuticle and nourish it from the inside out, for keeping the hair always moisturized and shiny. It can also be used to moisturize the skin.

Instruction Of Use
  • Apply to hair and skin after showering.
  • Gently massage hair and skin; To penetrate into the pores.
  • Leave on hair without rinsing.
  • A few drops of it can be used in the bathtub to relax.

Bundle Instruction Of Use

  • Take two pieces daily of Beauty Gummies.
  • Use Grow me shampoo.
  • Use mask me, hair mask.
  • Use hair oil.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Haifa's Favorites Collection - For Hair Care

ريال926.90
Chat now