Dermazone StoreDermazone StoreDermazone Store

Watermans Masque Me 200ml - Hair Mask Infused with Argan Oil


جميع الأسعار شاملة الضريبة

Treats dry and damaged hair
Treats split ends and frizz
Enhances hair glossiness
Suitable for all hair types
Safe for dyed hair
Softens and moisturizes hair
Nourishes the scalp; for healthier and stronger hair growth

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Watermans Hair Mask - Protect, repair, and moisturize hair from roots to ends

Product Overview

Hair Moisturizing Mask

Masque Me Hair Mask by Watermans is rich in vitamins and nutrients that nourish hair follicles, and enhance hair shine and health. It is made using the famous Watermans technology, which combines anti-hair loss efficacy, hydration and repair.

Masque Me is a hair mask infused with argan oil, and it contains a mixture of vitamins E, C, B6, B7, B3, antioxidants, rosemary extract, caffeine, lupine protein, and pro-vitamin B5.

Experts recommend using the Watermans' hair mask; Because it combines the protection, repair and hydration of hair from roots to ends. It is also considered as the best mask for dry hair.

Masque Me is effective and can be safely applied to the hair overnight; as it is free from any harmful chemicals such as sulfates, parabens, palm oil, and other harsh chemicals on the hair.

Product Information

Key Ingredients

Rosemary: Improves blood circulation in the scalp, nourishes the follicles, accelerates hair growth, and enhances its density.

Argan oil: Improves scalp health, enhances hydration, and protects hair from damage caused by heat styling and dyeing.

Lupine Protein: greatly nourishes the scalp and hair follicles; Because it contains a high percentage of protein.

Vitamin B3: Stimulates blood circulation in the scalp, nourishes the follicles, and promotes rapid, healthy hair growth.

Pro-Vitamin B5: enhances hair shine and density, increases hair strength and prevents hair loss.

Vitamin B6: prevents hair loss, and gets rid of scalp problems.

Vitamin B7: stimulates hair growth, strengthens its structure, reduces hair fall and breakage, and enhances luster.

Vitamin E: Stimulates blood circulation in the scalp, prevents hair loss, and enhances shine.

Vitamin C: Promotes collagen production, which is important for strengthening hair and enhancing its density.

Product Details

Pack capacity: 200ml.

Brand: Watermans

Age group: Adults.

Country of Origin: United Kingdom of Great Britain.

Skin type: All hair types.

Instructions for Use

  1. The mask is applied to wet hair after washing, starting from the ends to the roots of the hair.
  2. Gently massage the scalp for several minutes.
  3. Wrap the hair in a towel or shower cap; In order for the mask to penetrate into the hair.
  4. Leave the mask on the hair for 10 minutes, then rinse with lukewarm water.

Tip: For best results, it is recommended to use the mask on the hair once or twice a week.

Note: The results differ from one person to another according to the type of hair and the severity of its damage, but the product is trusted and approved by hairdressers.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail

Customer Reviews

Be the first to write a review
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Watermans Masque Me 200ml - Hair Mask Infused with Argan Oil

Chat now