Dermazone StoreDermazone StoreDermazone Store

Coxir Anti-Wrinkles & Dark Circles Eye Cream - 30 ml

ريال144.65

جميع الأسعار شاملة الضريبة

⦿ Coxir Eye Cream to protect under eye area
⦿ Help lifting under eye area, and reducing fine lines
⦿ Provides the necessary hydration for under eye area
⦿ All skin types
⦿ Reduces dark circles and puffiness
⦿ Reduces sebaceous cysts

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

We chose for you this light, easy to use, fast-absorbing cream for the under-eye area. To reduce the most prominent problems facing this area, such as sebaceous cyst, puffiness, fine lines, and dark circles; It contains natural moisturizing and nourishing ingredients that improve the health of the area.

This cream specifically focuses on problems in the under-eye area and reduces them within a short period of use. For having black rice extract, collagen, peptides, and niacinamide.

Product Details

Product size: 30 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Apply a small amount of cream to the under-eye area.

  • Use your fingertips to gently distribute the cream over the area.

Ingredients

  • Black Snail Gel Extract: maintains skin moisture and protects it from dryness, in addition to effectively improving skin elasticity.

  • Black Bean Extract: Contains nourishing vitamins and minerals that strengthen the skin barrier and give it a healthy appearance.

  • Natural Collagen: Provides deep hydration to the skin, reduces the appearance of fine lines and improves its texture.

  • Black Rice Extract: It contains a rich group of nourishing vitamins that resist the signs of aging, reduce wrinkles and fine lines, moisturize the skin, and get rid of impurities.

  • Black Sesame Extract: Improves the appearance of the skin, protects the skin from harmful environmental factors, and effectively moisturizes the skin.

  • Niacinamide: rejuvenates skin cells and reduces the appearance of wrinkles, fine lines, sebaceous cysts, and puffiness under the eyes.

  • Adenosine: soothes and repairs the skin, improving its health and texture.

  • Peptide: stimulates collagen production, skin regeneration, gets rid of fine lines and wrinkles, and helps significantly lifting the skin.

Why Use Under Eye Cream Black Snail Collagen

  • Reducing the most important problems of the under-eye area.

  • Help get rid of fine lines.

  • Contains highly moisturizing natural ingredients.

  • Free of all harsh ingredients on the skin, such as parabens and perfumes.

Warnings

  • For external use only.

  • Avoid contact with eyes.

  • Keep out of reach of children.

  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Anti-Wrinkles & Dark Circles Eye Cream - 30 ml

ريال144.65
Chat now