Dermazone StoreDermazone StoreDermazone Store
Sold out

Moms Bath Body Care Package

ريال548.55

جميع الأسعار شاملة الضريبة

  • Wash Off Body Milk for extra hydration
  • LHA Vitamin Glow Bath to get rid of dirt and oils
  • Strong Body Peeling Loofah to get rid of chicken skin and lightening skin tone
  • Wash Off Body Milk to lock hydration in skin and help lightening skin tone
  • Strong loofah to get rid of dead skin cells and scars marks

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

The Body Care Package by Moms Bath

Package Description

Discover our comprehensive body care package, featuring top-notch products designed to address various skin concerns. This package is tailored to purify, hydrate, and rejuvenate your skin, leaving it radiant and refreshed. Here's what it includes:

  1. Moms Bath Body Milk - 200ml
    This body milk is enriched with yogurt and honey extracts, providing maximum hydration for your body. Its advanced, quick-absorbing formula moisturizes and soothes the skin, promoting brightness without any sticky residue. Use it during or after your shower for the ultimate skin-loving experience.

    Usage Instructions:

    • Apply a generous amount to your wet body, then lather.
    • Rinse thoroughly and gently pat dry with a towel.
    • It can be used without rinsing for easy absorption.
  2. Moms Bath Exfoliating Body and Face Wipes with Vitamins - 45 Wipes
    These wipes deliver maximum freshness and radiance for up to 24 hours upon use. Packed with effective exfoliating vitamins and potent hydrating elements like hyaluronic acid mixed with panthenol, they remove dead skin cells and even out your skin texture.

    Usage Instructions:

    • Gently rub the entire body, focusing on dry areas, while pressing on the wipe during exfoliation.
    • Pay extra attention to challenging areas like elbows and knees for enhanced radiance.
    • Use the remaining oil on the wipe to moisturize and scent your hair.
    • Continuous use is recommended for deep cleansing and revitalizing your skin.
  3. Moms Bath Powerful Body Exfoliating Loofah
    This strong loofah excels at both exfoliating and cleansing your body simultaneously. It contains an effective cleansing solution made from fruit enzymes like pineapple and fermented pumpkin extract, which eliminate old dead skin, chicken skin, and scars. Additionally, it provides intense moisturization with seaweed extract. Each box contains 8 loofahs, each for single-use.

    Usage Instructions:

    • Completely rinse your body with water, then gently start lathering with the white side to produce rich keratin foam.
    • Use the green, patterned side on areas like ankles and elbows to remove old dead skin.
    • Rinse your entire body with lukewarm water.
    • Recommended use is 2-3 times a week.
    • A patch test on a small area of the skin is advised to ensure no allergies.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now