Dermazone StoreDermazone StoreDermazone Store
Sold out

Mielle Organic Hair Mask For Extra Hydration

ريال90.00

جميع الأسعار شاملة الضريبة

  • Meille mask, extra moisturizing for dull hair
  • Enhance scalp health
  • 100% natural oils
  • Contains paper mint oil, rosemary oil, biotin,honey
  • Nourishing hair from roots to end
  • Providing shiny, healthy hair in a short time

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Product Overview

Mielle Organic Hair Mask is made of biotin and the most important oils and natural elements such as mint and rosemary to strengthen, moisturize and improve hair thickness.

It contains one of the most powerful natural recipes that have proven effective in repairing hair and getting rid of damage.

Mielle Organic Mask is safe and effective even on the most severe types of hair damage, so it is especially recommended for dry hair. It can go into the hair deeply to provide it with important nutrition, which can get rid of damage, to have silky, shiny, healthy hair within a short period of use.

Product Details

Product size: 340 ml

Brand: Mielle Organics.

Made in: United States of America.

Instructions Of Use

  • Wash your hair very well with shampoo, then rinse it with water.

  • Apply the mask evenly on the hair from the roots to the ends.

  • Leave the mask on the hair for 15-20 minutes.

  • Rinse hair with lukewarm water.

Ingredients

  • Aloe Vera Leaves: It contains enzymes and antifungal properties that repair damaged hair and scalp, also improving follicle health and increasing hair growth, in addition to moisturizing the hair and eliminating dryness.

  • Sweet Almond Oil: Effectively moisturizes hair and improves scalp health.

  • Sunflower Seed Oil: It contains antioxidants and vitamin E that repair hair damage and moisturize it.

  • Olive Oil: Rich in the most important vitamins that moisturize the hair and strengthen the follicles for hair growth.

  • Macadamia Oil: One of the most famous oils to moisturize and nourish hair, also to get rid of dryness.

  • Shea Butter: Moisturizes and nourishes hair from the roots to the depths and locks moisture in the hair.

  • Ginger Root Oil: It strengthens hair growth, gets rid of frizz, and also softens hair.

  • Coconut Oil: Preserves hair protein and gets rid of hair problems such as split ends.

  • Peppermint Oil: Improves blood circulation in the scalp, which strengthens hair follicles and promotes growth.

  • Rosemary Oil: Reduces hair loss, strengthens hair, and improves hair growth.

  • Jojoba Oil: Rich in vitamins C, E, B and zinc, which improve scalp health and reduce hair loss.

  • Castor Oil: Effectively moisturizes hair, eliminates dryness, and reduces hair loss.

  • Chamomile Extract: Enhances hair shine and growth, and gets rid of split ends and dandruff.

  • Biotin: One of the most important proteins to strengthen hair follicles, to improve thickness and growth.

  • Honey: Effective moisturizing and nourishing hair.

Why Use Mielle Mask

  • 100% natural mask.

  • It contains natural ingredients that are important for hair health.

  • Free of harsh ingredients on hair such as parabens.

  • The perfect mask to get rid of dry hair.

Warnings

  • For external use only.

  • Avoid contact with eyes, and wash them immediately with warm water.

  • Keep it out of the reach of children.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
ن
نهيل طوخي
ممتاز

ممتاز جدا

Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now