Dermazone StoreDermazone StoreDermazone Store
بيع بالكامل
0%

    Melatonin Plus Chewable Tablets | Better Quality Sleep

    ريال183.25

    جميع الأسعار شاملة الضريبة

    • Reduces fatigue and tiredness
    • Significantly improves the quality of sleep
    • Reduces the time it takes time to fall asleep
    • Relaxes and rests the body
    • 60 Tropical fruit flavored tablets with non-addictive ingredients

    اخبرني عندما يكون هذا المنتج هو متاح:

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Viewers are watching this product now

    Melatonin Plus L-Theanine + 5-HTP - Sleep Aid

    Product Overview

    Melatonin Plus

    Without sleep, the body is unable to restore and repair, therefore, it is essential for good health and quality of life.

    Insomnia is often caused or worsened by lifestyle factors such as stress, lack of exercise, and poor diet, but there is hope: Melatonin Plus from Holista supports a better night’s sleep.

    Melatonin Plus combines three natural health products that are used as relaxants and sleep aids: 5-HTP (a plant-sourced amino acid), L-theanine (a compound found in green tea), and melatonin (a hormone). These sleep supporters come in delicious, naturally flavored, chewable tablets, helping to temporarily promote relaxation and reset the body’s sleep-wake cycle.

    How Melatonin Plus Works

    This formula is a wonderful choice for people who have trouble falling asleep and staying asleep. It helps increase the total sleep time in those suffering from sleep restriction or altered sleep schedule, such as shift-workers, and helps relieve the daytime fatigue associated with jet lag. Although not habit-forming, those with chronic insomnia should consult with a physician to rule out any underlying medical conditions.

    Benefits of Happy Melatonin Plus

    • Includes 5-HTP, used as a sleep aid and relax

    • Helps relieve the fatigue during the daytime associated with jet lag

    • Helps promote relaxation temporarily

    • Chewable tablets with delicious tropical fruit-flavored

    • Non-habit-forming formula

    Product information

    Medicinal Ingredients

    The Medical ingredient of Each Melatonin Plus tablet contains:

    • L-Theanine 100 mg

    • L-5-Hydroxytryptophan (L-5-HTP) (Griffonia simplicifolia) (seed) 15 mg

    • Melatonin (non-animal source) 1.5 mg

    Non-Medicinal Ingredients

    Dextrose, sucrose, stearic acid, xylitol, natural flavors, magnesium silicate, silica, citric acid, natural orange color (annatto, oleoresin paprika, turmeric).

    Product details

    Pack capacity: 60 chewable tablets.

    Brand: Holista.

    Age group: Adults.

    Industry: Canada.

    Instructions for Use

    Recommended dosage: Chew 2 tablets once daily with food or as directed by a physician at bedtime only.

    For Jet lag take with food at bedtime, while traveling, and at destination until adapted to the new daily pattern.

    How to Achieve the Best Results

    • Take it with food.

    • Take it at bedtime.

    • For all uses consult a physician for use beyond 4 weeks.

    Warnings

    • Consult a physician prior to use if you have cardiovascular, immune, liver, or any disease.

    • Consult a physician prior to use if you are taking steroids or blood thinners, medications for seizure or blood pressure.

    • Do not drive or use machinery for 5 hours after taking melatonin.

    • Avoid taking alcohol or products that increase drowsiness.

    • Stop use if an allergy occurs or if you experience headache, confusion, or nausea.

    • Discontinue use and consult a physician if you show signs of weakness, oral ulcers, or abdominal pain accompanied by severe muscle pain, or if you experience skin changes.

    • Do not use it if you have scleroderma or if you are pregnant or breastfeeding.

    • Consult a physician if sleeplessness persists for more than 4 weeks (chronic insomnia).

    • Some people may experience diarrhea, nausea, vomiting, and abdominal pain.

    • Keep out of reach of children

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


    Customer Reviews

    Be the first to write a review
    0%
    (0)
    0%
    (0)
    0%
    (0)
    0%
    (0)
    0%
    (0)
    Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
    الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
    يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your shopping cart is empty.

    Back to Shop

    Add notes to the order Edit notes
    Estimate shipping costs
    Add discount code

    Estimate shipping costs

    Add discount code

    The coupon code will work on the checkout page

    تحدث الان