Dermazone StoreDermazone StoreDermazone Store

Hair Thickening and Growth Kit - GrowMe Shampoo + Beauty Gummies


جميع الأسعار شاملة الضريبة

Promotes hair growth and scalp health
Stimulate hair growth and strengthening of nails
Safe and suitable for all hair types, sulfate and paraben free
Contains delicious, low-calorie, gluten-free candy like vitamins
Lasts for one month

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Hair Thickening and Growth Kit 

This package for hair and nails care contains a bottle of GrowMe Shampoo to thicken hair and enhance its strength, and a box of Beauty Gummies to enhance hair density and strengthen the nails.

This bundle contains the following features:

Grow Me Shampoo

GrowMe Shampoo by Watermans, is one of the best shampoos that have proven effective with the testimony of hair experts and users; As it is a shampoo composed of natural ingredients that are effective in thickening hair, improving the scalp, and significantly reducing hair loss, in addition to its intense hydration of hair, and it is free of sulfates and parabens. 

Key Ingredients:

Biotin: nourishes the scalp and protects hair from hair loss.

Caffeine: stimulates hair growth, enhances blood flow to the scalp, and maintains hair moisture.

Argan Oil: improves scalp health, boosts hydration, and protects hair from damage caused by heat styling and dyeing.

Lupine protein: greatly nourishes the scalp and hair follicles; Because it contains a high percentage of protein.

Rosemary: improves blood circulation in the scalp, nourishes the follicles, accelerates hair growth, and enhances its density.

Vitamin B3: Stimulates blood circulation in the scalp, nourishes the follicles, and promotes rapid, healthy hair growth.

How To Use: 

  1. Wet hair and use a small amount of shampoo on it.
  2. Gently massage the hair and scalp, leave the shampoo on for 3-4 minutes, and then rinse it off with water.
  3. Use the shampoo 4-5 times a week for best results.

Beauty Gummies

Beauty Gummies by Sensilab, is made up of chewing gummies rich in biotin, which is critical for the health and growth of hair, and for strengthening nails against brittleness and breakage. The product also stimulates collagen production in the body; To promote and protect hair and nail growth.

Key Ingredients:

Biotin: Promotes the growth of cells responsible for hair growth, thus stimulating hair growth and strengthening it, as well as strengthening and maintaining nails.

Caffeine: improves blood flow to the scalp, thus stimulating hair growth and keeping it hydrated.

Green tea: It strengthens hair through its antioxidant-rich properties, enhances hair's shine and vitality, and strengthens nails against brittleness.

Vitamins C, D3, E: These vitamins promote hair growth and health, delay the appearance of gray hair, and strengthen nails and enhance their health.

How to Use:

  1. Eat two gummies daily.
  2. Consume gummies either before food or while eating.

The Best Hair and Nail Growth Bundle

We have selected this bundle for you simply due its highly effective ingredients that strengthen hair and nails.

What to Expect?

 You will initially notice reduction in hair loss and more hair volume, and a significant increase in nail strength. However, according to our satisfied customers, the most effective and desired results usually appear after using both products for a period of no less than three months.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail

Customer Reviews

Be the first to write a review
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Hair Thickening and Growth Kit - GrowMe Shampoo + Beauty Gummies

Chat now