Dermazone StoreDermazone StoreDermazone Store
بيع بالكامل

Dermaceutic Oxybiome 400ml - Cleanser Micellar Water

ريال212.75

جميع الأسعار شاملة الضريبة

Reduces the marks of pigmentations and redness
Purifies oily, acne, prone skin
Balance the pH of the skin
Treats any cracks in the skin
Suits all skin types

اخبرني عندما يكون هذا المنتج هو متاح:

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Product Overview

Dermaceutic Oxybiome is an effective cleanser that purifies the skin from all residue or external pollutants and toxins. It also acts as a make removal to wash off thick makeup, and supports the skin’s natural microbiota which fights harmful bacteria and pollutants that causes skin problems.

Oxybiome cleanser supports healthy skin by balancing the pH, and reducing the marks of blemishes such as pigmentations and redness.

Product Information

Main Ingredients

  • Microbiota Regulator: extracted out of several natural nutrients that treat inflammation, and relieves both redness and pigmentations in the skin.

  • Zinc gluconate: it minimizes the appearance of enlarged pores, regulates sebum, cleanses the skin, and stimulates the speed of wound healing in the skin.

  • Niacinamide: it contains both vitamin B3, and vitamin PP, that help soothing the skin, and balance sebum production and prevent acne upon the face.

Product Details

Pack capacity: 400 ml.

Brand : Dermaceutic.

Used category: Adults.

Origin country: France.

Skin type: All skin types.

How To Use

  • Apply to a piece of cotton, and wipe all the face and eyes twice a day, in the morning and evening, and leave it without washing.

  • Keep out of reach of children.

Dermaceutic Oxybiome Test Results

The laboratory results of the European Independent Clinical Research organization upon 23 volunteers for 28 days show the following.

  • 100% of users confirm that the skin recovery increased after using the product.

  • 100% of users confirm that the impurities have disappeared, and the skin looks clear and smooth after using the product.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

No reviews yet
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 333): Error in tag 'section' - 'AIO_product_review' is not a valid section type
الاحد,الاثنين,الثلاثاء,الاربعاء,الخميس,الجمعة,السبت
يناير,فبراير,مارس,ابريل,مايو,يونيو,يوليو,اغسطس,سبتمبر,اكتوبر,نوفمبر,ديسمبر
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

تحدث الان