Dermazone StoreDermazone StoreDermazone Store

Coxir Purifying Pores Bundle

ريال585.25

جميع الأسعار شاملة الضريبة

  • powerful cleansing oil to get rid of makeup traces, dirt and impurities
  • black rice and charcoal mask to get rid of black and white heads
  • hyaluronic acid toner to sooth and hydrates skin, and to get rid of stucking impurities
  • hyaluronic acid emulsion to hydrate skin pores and get rid of dehydration
  • all skin types

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Bundle Overview

This bundle provides all the necessary products to purify skin pores and cleanse it of all impurities, dirt residue, makeup, and oils that cause many skin problems, such as:

  • Clogged pores, dirt accumulation, pimples, skin infections, black and white heads.

  • Accumulation of dead skin cells causing skin dullness.

  • Preventing the skin from absorbing and benefiting from the active ingredients in skin care products.

This bundle includes four products that, used in order once a week, provide deep cleansing and hydration without causing dryness or irritation. These products include all of the following.

1 Coxir Ultra Hyaluronic Acid Cleansing Oil - 150 ml

Skin cleansing oil effectively gets rid of white and black heads from the first use. Due to its light oily texture, rich in herbal extracts that dissolve impurities and oils in the pores to make it easier to get rid of them without harming the skin pores, Also it contains hyaluronic acid for rich moisturizing.

Instructions Of Use
  • Apply facial oil on dry palms and then gently massage it all over the face.

  • Rinse the face well with lukewarm water.

1 Coxir Black Rice TXA Pore Purifying Mask - 50 ml

This mask cleanses the skin and purifies the pores of all dirt. For having active ingredients such as natural charcoal to absorb oils, black rice for deep cleansing, snail gel extract, black beans and panthenol to moisturize and nourish the skin.

Instructions Of Use
  • Clean the face well with cleanser.

  • Use a proper amount of the mask on the entire face, or on the T zone, the forehead, nose, and chin.

  • Leave the mask on for 1-2 minutes, and massage gently with your fingertips for 15 seconds.

  • Rinse the face well with lukewarm water and dry it.

1 Coxir Ultra Hyaluronic Acid Toner - 150 ml

Hyaluronic acid toner removes all remaining traces of impurities, oils, and dirt stuck in the pores and soothes them. It also balances the moisture level between fluids and oils in the skin.

Instructions Of Use
  • Clean the face well.

  • Use enough toner on a piece of cotton or on the palm of the hand and wipe the entire face with it.

  • It is recommended to soak 6-7 pieces of cotton and then place them on the skin for 5 minutes if the skin is very dry.

1 Coxir Ultra Hyaluronic Acid Emulsion - 100 ml

This emulsion locks in moisture in the skin and protects it from dryness for having a high percentage of highly absorbent hyaluronic acid and aloe vera extract.

Instructions Of Use
  • Clean the skin well.

  • Wipe the entire face with toner to enhance absorption.

  • Use a proper amount of emulsion on the face and distribute it gently.

Bundle Instructions Of Use

  • Cleanse the face well with cleansing oil and give it a light massage.

  • Use the mask after washing the skin from oil.

  • Use toner.

  • Use hyaluronic acid emulsion as a final step to moisturize the pores after cleaning them and lock moisture into the skin.

Other Instructions Of Use

You can use the products of this bundle in another way, as follows.

  • Use both toner and emulsion separately daily in your skin care routine.

  • Use the emulsion before applying makeup to prepare the skin and enhance its radiance.

  • Use cleansing oil to wipe off makeup and cleanse the skin well before using cleanser.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Coxir Purifying Pores Bundle

ريال585.25
Chat now