Dermazone StoreDermazone StoreDermazone Store
0%

    Garcinia Cambogia - Fat Burning Dietary Supplement

    ريال136.85

    جميع الأسعار شاملة الضريبة

    One of the best products for fat burning
    Suppresses the appetite
    Limits the storing of fat in the body
    Contains 500 mg of Garcinia Cambogia extract
    Regulates blood sugar levels

    Sold out

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Order during to get it on hoursminutes
    Viewers are watching this product now

    Product Overview

    Garcinia by Sensilab is a fat burning dietary supplement that is used for:

    • Losing weight in healthy way
    • Reducing the appetite  
    • Increasing the sense of satiety for the longest possible period 
    • Break up the accumulated fat in the abdomen and buttocks.

    The Garcinia Drink contains 100% Natural  extract of garcinia cambogia fruit, which is a tropical fruit widely grow in India, and is considered a food supplement and an important factor for weight loss, as it limits the body's ability to make fats and suppresses appetite, and it can also help maintain blood sugar and cholesterol in normal levels.

    How does Garcinia supplement drink work?

    1. Burns fat
    The main active ingredient of weight loss increases the rate of fat burning - hydroxy citric acid or HCA.

    2. Prevents fat accumulation
    Hydroxy-citric acid slows the action of the enzyme that converts carbohydrates and sugars into accumulated fats.

    3. Controls appetite
    Hydroxy-citric acid increases the level of serotonin in the blood, reducing the need for excessive eating due to emotions or bad mood.

    Product Information

    Instructions of Use

    The recommended dose is Take two sachets daily, dissolved in a glass of water after meals.

    Warnings and Important Notes

    If you are allergic to any of the ingredients in this product or take the medicine. Consult your doctor before use. The product is not recommended for pregnant and breastfeeding women.

    Do not exceed the recommended daily dose. Dietary supplements are not used as a substitute for a balanced and varied diet. A varied and balanced diet and a healthy lifestyle is important.

    Keep away from the reach of the children. Store in a dark, dry place at a temperature below 25 ° C.

    Product Details

    Package Contents: 15 sachets.

    Net Weight: 51.2 grams.

    Brand: Sensilab

    Ingredients

    Dietary supplement. Contains caffeine. Not recommended for children or pregnant women (caffeine content: 30 mg / per sachet).

    Active ingredients in one sachet:

    Garcinia Cambogia Extract 500 mg (hydroxcitric acid content 300 mg), and Guarana extract 300 mg (caffeine content 30 mg).

    Frequently Asked Questions 

    What are the active ingredients in the Garcinia Fruit?

    Perhaps the presence of the organic acid, which gives the distinctive taste of this type of fruit, which is known as (hydroxycitric acid) and is denoted by the symbol (HCA), and which is similar to the general citric acid found in many citrus fruits.

    The active ingredient in guarana extract

    This fruit contains twice as much caffeine as coffee beans, and is released more slowly into the body, increasing vitality, energy and cognitive function. Moreover, it contributes to fat metabolism and improves the results of any diet.the caffeine, which is characterized by having thermal properties (it increases the calorie burning rate), in addition to its special effect to improve mood.

    What is the importance of the acids found in the Garcina fruit?

    This acid, symbolized by it (HCA), is very effective in reducing the percentage of accumulated fat in the body, as it works to reduce the conversion of sugary substances into fats stored in the body, by its direct effect and inhibiting the action of one of those enzymes responsible for this metabolism of sugar in the blood.

    This leads to an increase in the percentage of glycogen in the liver, which in turn sends specific signals to the brain, which translate into depressing appetite for more foods.
    Also, eating this acid (HCA) leads to an increase in the migration of fats from their storage sites in the body, and then working to burn them, and this is known as the self-burning feature of fats in the body.
    That is why the most important use of HCA is to lose weight, and reduce the urge for eating more.

    Who should take Garcinia fat burner drink?

    The Garcinia Supplement is suitable for everyone! It is free of substances that could damage your body and does not cause any side effects. You should take it if:

    • you want to lose excess pounds faster
    • you want to add extra help to your diet,
    • you want to shape the body and get rid of the last fat layers,
    • you want to add to your diet a supplement with 100% natural ingredients and free of artificial substances.

    The delicious & refreshing drink is great for anyone who wants to achieve a beautifully shaped physique : it effectively helps regulate body weight and contains only natural ingredients.

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


    Customer Reviews

    Based on 7 reviews
    71%
    (5)
    0%
    (0)
    14%
    (1)
    14%
    (1)
    0%
    (0)
    F
    Fatoon

    اليوم وصلتني الطعم حلو والله ننتظر النتيجه

    M
    Moza Alkuwari

    لم اجد اي نتيجة

    ب
    بشرى البلوي

    شراب جارسينيا كامبوجيا لحرق الدهون - Garcinia Cambogia

    ع
    عبدالعزيز حمد العنزي
    تقيم المنتج

    والله رهيب وانصح فيه يحرق الوزن مع الدايت والرياضه وحتى يساعدك مايخليك تتعب او تتكسر وسويت تجربه هل انه فعال او لا جربته بدون دايت وبدون رياضه يثبت الوزن واذا ارتفع الوزن بكيلو او كيلوين وانا والله انصح فيه وطعمه حلو مره

    G
    Ghofran Alahmadi

    شراب جارسينيا كامبوجيا لحرق الدهون - Garcinia Cambogia

    Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
    Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
    January, February, March, April, May, June, July, August, September, October, November, December
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your shopping cart is empty.

    Back to Shop

    Add notes to the order Edit notes
    Estimate shipping costs
    Add discount code

    Estimate shipping costs

    Add discount code

    The coupon code will work on the checkout page

    Garcinia Cambogia - Fat Burning Dietary Supplement

    ريال136.85
    Chat now