Dermazone StoreDermazone StoreDermazone Store
Sold out
0%

    AnteAge Lash Serum - Eyelash Growth Enhancing Serum

    ريال557.20

    جميع الأسعار شاملة الضريبة

    Lengthens eyelashes gives it volume
    contains 12 stimulants for hair growth and extension
    Promotes eyelash hair growth
    Fortified with peptides hyaluronic acid and biotin for healthy hair growth
    Free of parabens, prostaglandins and fragrances

    Tell me when this product is available

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Viewers are watching this product now

    Anteage Overnight Lash Serum 3.5 ml - Increases length and fullness of the lashes

    Product Overview

    AnteAGE® Overnight Lash Growth Serum is a powerful and natural eyelash hair growth enhancing serum. It is the key to obtaining thick, long, beautiful lashes.

    The unique serum contains twelve hair growth factors and is free of parabens, prostaglandin, and fragrances.

    Benefits of Anteage Lash Serum

    • Gives fullness to lashes.

    • Gives thicker lashes.

    • Free of parabens, prostaglandin, and fragrances.

    • Lengthens lashes and gives them volume.

    • Enhanced with peptides, hydrating hyaluronic acid and biotin for healthy hair growth.

    • Contains twelve hair growth factors.

    • No lash extensions are needed.

    Product Information

    Instructions for use

    1. Apply Lash Serum to the base of lashes by using the vial applicator brush.

    2. Apply the serum 1-2 times daily.

    Warnings

    • Do not exceed the recommended dose.

    • Do not leave the product within the reach of children.

    Product details

    • Pack Size: 3.5 ml

    • Age Group: 18+

    • Made In: USA

    • Brand: Anteage

    Ingredients

    Water, Hyaluronic Acid, Oryza Sativa (Rice) Bran Extract, Panax Ginseng Extract, Thuja Orientalis Extract, Polygonum Cuspidatum Extract, Acanthopanax Koreanum Extract, IGF-1 (sh-Oliogopeptide-2), IGF-2 (sh-Polypeptide-31), aFGF (sh-Polypeptide-11), bFGF (sh-Polypeptide-1), KGF (sh-Polypeptide-3), KGF-2 (sh-Polypeptide-10), SCF (sh-Polypeptide-4), CSF-1 (sh-Polypeptide-73), PDGF-A (sh-Polypeptide-8), EPO (sh-Polypeptide-72), Noggin (sh-Polypeptide-13), CG-VEGF (sh-Polypeptide-9), Carnitine, Baicalin, Biotin, Dehydroacetic Acid, C12-15 Alkyl Benzoate, Tocopheryl Acetate, Ubiquinone, Benzyl Alcohol as preservative.

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


    Customer Reviews

    Based on 1 review
    100%
    (1)
    0%
    (0)
    0%
    (0)
    0%
    (0)
    0%
    (0)
    ل
    لطيفه محمد
    أحس نفس مثل نجمات هوليود ههههههه

    الرموش كثيفة صارت تبارك الله مشاءالله، قل تساقطها

    Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
    January, February, March, April, May, June, July, August, September, October, November, December
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your cart is empty

    Back to Shop

    Add notes on Order تعديل الملاحظات
    Estimate shipping costs
    Add a discount code

    Estimate shipping costs

    Add a discount code

    The coupon code will work on the checkout page

    Chat now