Dermazone StoreDermazone StoreDermazone Store
Sold out

Watermans Travel Size Shampoo and Conditioner Set

ريال138.00

جميع الأسعار شاملة الضريبة

 Travel sized Shampoo and Conditioner
 Helps maintain a healthy hair care routine during travel
 Convenient and easy to carry
 Lasts for 10 days
Suitable to all hair types

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Watermans Travel Set - Travel Sized Shampoo and Conditioner - 75ml

This set is designed; To be easy to carry while traveling and to help maintain a healthy hair care routine during travel. However, for guaranteed results you should buy the full size packs, and use both shampoo and conditioner 4-5 times a week for three months; The quantity in the travel set is sufficient for use only approximately 10 days.

Watermans Travel Set Contents

Watermans launched a travel set that contains shampoo and conditioner travel sized bottles; To maintain the hair care routine while traveling without worries.

Travel Size GrowMe Shampoo

Composed of high-quality natural elements, this shampoo protects hair from damage and loss, and nourishes the scalp; For healthy hair growth, it is suitable for all hair types, and dyed hair. Your hair care routine can be carried on, protecting it from hair loss, maintain its vitality and moisture while traveling anywhere easily.

Key Ingredients

Biotin: Nourishes the scalp and protects hair from hair loss.

Caffeine: Stimulates hair growth, enhances blood flow to the scalp, and maintains hair moisture.

Argan Oil: Improves scalp health, boosts hydration, and protects hair from damage caused by heat styling and dyeing.

Lupine protein: Nourishes the scalp and hair follicles; Because it contains a high percentage of protein.

Rosemary: Improves blood circulation in the scalp, nourishes the follicles, accelerates hair growth, and enhances its density.

Vitamin B3: Stimulates blood circulation in the scalp, nourishes the follicles, and promotes rapid, healthy hair growth.

Travel Sized Condition Me Conditioner

This double-moisturizing conditioner contains high-quality natural ingredients that enhances the shine of the hair, moisture, and vitality. It is key during travel to maintain the shine and moisture of your hair at all times.

Key Ingredients

Caffeine: Stimulates hair growth, enhances blood flow to the scalp, and maintains hair moisture.

Lupine protein: Greatly nourishes the scalp and hair follicles; Because it contains a high percentage of protein.

Rosemary: improves blood circulation in the scalp, nourishes the follicles, accelerates hair growth, and enhances its density.

Vitamin B3: Stimulates blood circulation in the scalp, nourishes the follicles, and promotes rapid, healthy hair growth.

Antioxidants: Promote hair growth and prevent hair loss.

Glycerin: Moisturizes hair, repairs breakage, and promotes hair growth and strength.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Chat now