Dermazone StoreDermazone StoreDermazone Store

L-Carnitine Weight Loss & Fat Burning Package

ريال652.05

جميع الأسعار شاملة الضريبة

  • Three packs L-Carnitine
  • Efficiently eliminate accumulated fat in a record time
  • Enhance the body's fat-burning process & calorie consumption
  • Composed of L-Carnitine, Green Tea, and Garcinia Cambogia
  • Effectively reduce appetite
  • A safe product recommended by experts

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Package Description

This package contains 3 packs of L-Carnitine designed to help you lose weight and eliminate stubborn fat. It is enriched with a carefully measured amount of the amino acid L-Carnitine, which converts fat into energy, helping you burn excess calories. Additionally, it includes extracts of green tea and Garcinia Cambogia, working together to burn accumulated fat, reduce appetite, and prevent the accumulation of new fat.

Product Details

  • Package Size: 2000 mg per serving, with 15 servings per package.
  • Brand: Sensilab
  • Age Category: Adults Only
  • Country of Origin: Slovenia

Usage Instructions

Consume one full sachet of L-Carnitine daily. Here are some tips to achieve the best results

  • It is recommended to take L-Carnitine on an empty stomach before consuming anything in the morning to enhance absorption.
  • Alternatively, you can take L-Carnitine half an hour to an hour after a substantial meal to boost the burning of fat from that meal.
  • Another option is to take L-Carnitine about an hour before engaging in any physical exercise or physical activity.
  • It is advisable to consume L-Carnitine during the morning or early afternoon, as the product contains green tea extract, which is classified as a stimulant, to avoid nighttime restlessness.

You can choose the method that suits you best based on the above recommendations, knowing that any method will achieve the desired results.

Benefits of L-Carnitine

  • Effective triglyceride fat burning.
  • Improved fat burning throughout the body.
  • Noticeable appetite reduction.
  • Prevention of new fat storage in the body.
  • Preservation of muscle mass.
  • Enhanced metabolic processes.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

L-Carnitine Weight Loss & Fat Burning Package

ريال652.05
Chat now