Dermazone StoreDermazone StoreDermazone Store
Sold out

L- Carnitine Fat Burning Supplement

ريال217.35

جميع الأسعار شاملة الضريبة

body>

  • Optimal L-Carnitine Dosage for Triglyceride Reduction
  • Aids in Weight Loss in a Short Time Frame
  • Boosts Your Body's Fat-Burning Mechanism
  • L-Carnitine, Green Tea, and Garcinia Cambogia
  • Curbs Your Appetite
  • Endorsed as a Safe and Expert-Recommended Product

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

L-Carnitine Powder

Fat Burning & Energy Enhancing Supplement

Product Overview

L-Carnitine by Sensilab is a refreshing naturally mango flavored powder, that raises energy levels, prevents fatigue and increases performance.

The product is made up of a unique blend with a synergistic combination of the purest L-Carnitine and 3 high-power thermo burners (guarana, green tea and mate tea), in addition to papaya fruit extract and vitamin B3; this unique formula melts fat 5 times faster!

Extremely Effective Formula

  • Green tea: mate tea and guarana are well-known thermo burners, which make the body speed up fat burning to produce more heat.
  • L-Carnitine: is essential for melting and consuming fats and producing energy. It carries most of the fats we consume to the fat-burning core of our cells , the mitochondria. Without L-Carnitine, we wouldn't be able to burn fat or get energy from it!
  • Papaya fruit extract: on the formation and sculpting of the body and fat dissolution. It also helps in digesting protein, and this helps to build muscle and thus increase the muscle percentage of fat.
  • Vitamin B3: helps convert food into energy.

Ingredients

carrier: acacia gum, guarana seed extract with %10 caffeine, L-carnitine L-tartrate, papaya mature fruit juice powder with 1500 USP units proteolytic activity of papain, green tea leaves extract with %50 total polyphenols and %6-2 caffeine, green mate leaves extract with %8 caffeine, natural mango flavor,anti-caking agent: rice concentrate, acidity regulator: citric acid,sweetener: sucralose (80mg/L), nicotinamide.

Product Details

  • One pack contains: 15 sachets.
  • Net weight:130 grams.
  • Brand: Sensilab
  • Age Group: Adults
  • Made In: France

Use and Preparation

The recommended daily dose is one sachet dissolved in a cup of water after a meal. For best results, take it 30 to 60 minutes before engaging in physical activity.

Warnings

  • If you are hypersensitive or hypersensitive to any component of the product or using the medication, consult your doctor before use.
  • This product is not recommended for pregnant or breastfeeding women.
  • The recommended dose should not be exceeded daily.
  • Dietary supplements are not used as a substitute for a varied and balanced diet and a healthy lifestyle. A varied and balanced diet and a healthy lifestyle is important.

Storage

Keep away from the reach of the children! Store in a dark, dry place at a temperature below 25 ° C.

Frequently Asked Question

How important is L-Carnitine?

The function of carnitine in the body is to transport fats to the cell's energy factories, which are called - mitochondria. Only in this way the body can convert it into energy. The product also contains a group of 100% natural and effective extracts of green tea, guarana, mat tea, papaya fruit extract, and vitamin B3, which effectively contribute to burning fat, producing energy and reducing feeling of fatigue and exhaustion.

Studies have shown that the L-Carnitine supplements will speed up melting and burning fats. The L-Carnitine Drink from Sensilab will:

  • Helps you to dissolve and burn fat by 16% while exercising.

  • Help you lose weight 5 times faster.

  • It has a thermal effect on your body - meaning you will burn more calories and fat even in rest.

  • Increases the effect of exercise

  • It gives you remarkable results with all types of physical activity - walking, running, or even while playing with your children.

How does L-Carnitine Poweder work?

  • The Smart Ingredients combo in L-Carnitine begin to dissolve fat instantly, and lasts for 4 hours

  • Triple action: increases the body's ability to burn fat, converts fat into energy and increases endurance during exercise.

  • The Vitamin B3 and papaya extract allows our smart ingredients combo turns the food you consume into more energy instead of fat

  • Works with or without exercise.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Chat now