Dermazone StoreDermazone StoreDermazone Store

    Watermans Grow Me® Shampoo 250ml - Hair Growth Shampoo


    جميع الأسعار شاملة الضريبة

    • Promotes healthy hair growth
    • Rejuvenates the scalp
    • Adds more volume to the hair
    • Prevents hair loss
    • Treats hair loss for both men and women
    • Sulfate free

    Sold out

    madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
    Order during to get it on hoursminutes
    Viewers are watching this product now

    Grow Me® Shampoo

    Treats Hair Loss & Promotes Hair Growth

    Product Overview

    Grow Me Shampoo by Watermans is made up of an effective formula that contains natural active ingredients which aid in treating hair loss, and increasing natural hair growth from the scalp. 

    It has been shown in numerous studies and clinical trials that GrowMe Shampoo is deemed effective in preventing hair loss and promoting hair growth over a period of time. 

    Grow Me shampoo is formulated with effective natural ingredients including:

    1. Biotin 
    2. Caffeine 
    3. Argan oil
    4. Rosemary extract 
    5. Niacinamide 
    6. Allantoin 
    7. Lupine protein 

    Together these ingredients make the scalp an ideal environment for hair growth. It is fast, effective and ideal for both men and women. It is also suitable for all hair types.

    Facts About Grow Me Shampoo

    • Sold millions of shampoo bottles worldwide.
    • UK Hair Award Winner.
    • Sulfate free, paraben free.
    • A vegan, non-animal tested product
    • PETA certified
    • Made in the UK
    • Recommended and sold by Hairdressers
    • Certified by the Vegetarian Society.

    Benefits of Grow Me Shampoo

    • Stimulates hair growth
    • Promotes healthy hair growth
    • Prevents hair loss
    • Revitalizes and strengthens hair follicles
    • Treats hair loss for both men and women
    • Increases hair volume
    • Promotes healthy scalp


    Grow Me Shampoo contains a variety of vitamins and antioxidants such as:

    • Vitamin H
    • Vitamin B7 Biotin
    • Vitamin E
    • Vitamin C
    • Vitamin B6
    • Vitamin B3
    • Calcium pantothenate, which converts to vitamin B5, that helps moisturize the scalp.

    Instructions for Use

    1. Use a small amount of the shampoo on damp hair.
    2. Massage the scalp and leave it on the scalp for 3-4 minutes, then rinse with water.
    3. Use 4-5 times a week for best results.

    Product Details

    Pack Size: 250ml

    Age Group: 18+

    Made In: United Kingdom

    Brand: Watermans


    Avoid contact with eyes, if this occurs rinse immediately with clean water.

    Return and refund policy:

    Reporting problems must be within 7 days of the order date.

    Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

    The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

    Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

    Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

    The refund from the company will be through the same method of payment by the customer.

    The estimated amount paid by the company shall be refunded within 7 to 21 working days.

    cancelling the order before processing and shipping can be done without incurring shipping costs.

    refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

    cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

    Please don't hesitate to contact us for any problem through e-mail

    Customer Reviews

    Based on 274 reviews
    Afnan Howais

    ممتاز ماشاءالله

    دلال الأحمدي


    asma alqahtani


    هدى علي

    شامبو جرومي لتكثيف و وقف تساقط الشعر

    Sadia Ahmed

    شامبو جرومي لتكثيف و وقف تساقط الشعر

    Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
    Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
    January, February, March, April, May, June, July, August, September, October, November, December
    لا تتوفر عناصر كافية. بقي [max] فقط.
    Add to My WishlistBrowse my WishlistDelete from my Wishlist
    Shopping cart

    Your shopping cart is empty.

    Back to Shop

    Add notes to the order Edit notes
    Estimate shipping costs
    Add discount code

    Estimate shipping costs

    Add discount code

    The coupon code will work on the checkout page

    Watermans Grow Me® Shampoo 250ml - Hair Growth Shampoo

    Chat now