Dermazone StoreDermazone StoreDermazone Store
Sold out

Excite Fly for Women 15ml - Female Arousal Gel

ريال205.85

جميع الأسعار شاملة الضريبة

Enhances female orgasm and arousal
Reduces dryness vagina
Extracted from Natural ingredients
Safe and easy to use
Stimulates sexual desire in women and increases pleasure

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Excite Fly - Female Arousal Gel and Orgasm Stimulant 

Product Overview

Increase Enjoyment and Sexual Arousal

Excite Fly increases arousal in women and enhances the orgasm for extreme pleasure. It is a safe natural cream extracted from high quality natural ingredients that improve female orgasm and pleasure. It is also characterized by its moisturizing texture that reduces vaginal dryness.

Ideal for Stimulating and Prolonging Relations With Your Partner

EXCITE FLY is the incomparable orgasm enhancer that combines vegetable extracts with known invigorating properties hyperaemic action (reddening of the skin); you will notice a pleasant hot, cold or tingling feeling, that will increase the sensation in your intimate areas.

Product Information

Main ingredients

Damiana extract: The extract of the aromatic leaves in it contains substances that stimulate the orgasm of women, thus stimulating the sexual pleasure of both partners.

Guarana bush extract: This extract contains stimulants such as caffeine that stimulate orgasm; To increase desire in women.

Maca bush extract: This extract contains various substances such as blood-stimulating glucosinolates, which are very stimulating to sexual desire, especially their effect on the pelvic area.

Arginine: This amino acid stimulates metabolism and improves blood circulation.

Ginseng extract: The oils extracted from it are rich in sexual stimulants.

Ginkgo biloba shrub extract: This extract contains sexual tonic elements, it also stimulates blood circulation, and stimulates oxygen in the blood.

Product Details

Pack capacity: 15ml.

Brand: Excite

Age group: adults.

Country of Origin: Spain.

Skin type: All skin types.

Storage temperature: Keep in a dry place.

Instructions for Use

Apply a little product on the forearm to ensure that there is no allergic reaction before use.

Apply 2-3 small drops of the product to the palm of the hand, after making sure that there is no allergic reaction.

Gently massage the intimate area from the inside until the product is completely absorbed.

Keep out of reach of children.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Chat now